PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10010086m
Common NameCARUB_v10010086mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 253aa    MW: 28834.1 Da    PI: 5.2475
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10010086mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd++lv ++ ++G g+W+  +++ g++R++k+c++rw+++l
  Carubv10010086m 14 RGEWTEEEDQKLVAYIDEYGVGDWRFLPERAGLRRCGKSCRLRWLNFL 61
                     89********************************************97 PP

2Myb_DNA-binding54.13.7e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g++T++E++ ++ ++  lG++ W++Ia+ m+ +R+++++k++w++ 
  Carubv10010086m  67 KGKFTPQEEQTIISLHSVLGNR-WAAIAQQMP-NRSDNDIKNHWNSC 111
                      79********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.083961IPR017930Myb domain
SuperFamilySSF466891.47E-2912108IPR009057Homeodomain-like
SMARTSM007172.8E-141363IPR001005SANT/Myb domain
PfamPF002491.3E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-221568IPR009057Homeodomain-like
CDDcd001672.67E-101661No hitNo description
PROSITE profilePS5129425.17162116IPR017930Myb domain
SMARTSM007174.6E-1566114IPR001005SANT/Myb domain
PfamPF002492.6E-1667111IPR001005SANT/Myb domain
CDDcd001671.74E-969109No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2469116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MGRATWFEAD GTKRGEWTEE EDQKLVAYID EYGVGDWRFL PERAGLRRCG KSCRLRWLNF  60
LRPGINKGKF TPQEEQTIIS LHSVLGNRWA AIAQQMPNRS DNDIKNHWNS CLKKRLERNG  120
INPVTHQPFV SNLVVKTSLF NTECSSSSSA NASPSFSSGS ACLLNKIATG ISSRQHCVDR  180
MKNILSGSRT TSIHCHEEEE DEGEELNRDD HEKILASGYQ EEDFLMWDEE ELRRFMEEIG  240
VMEFGTTSYD CN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28141177109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303290.10.0hypothetical protein CARUB_v10010086mg
TrEMBLR0IH740.0R0IH74_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_10016921e-132(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18710.14e-93myb domain protein 47